SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005406 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005406
Domain Number 1 Region: 2089-2163,2190-2239,2305-2330,2368-2566
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.89e-86
Family Hect, E3 ligase catalytic domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 1232-1300
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.22e-22
Family Mib/herc2 domain 0.0000087
Further Details:      
 
Domain Number 3 Region: 335-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-20
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 15-182,500-574
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000202
Family Armadillo repeat 0.025
Further Details:      
 
Domain Number 5 Region: 1052-1204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000247
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005406   Gene: ENSDORG00000005774   Transcript: ENSDORT00000005776
Sequence length 2574
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_946:9731:85477:-1 gene:ENSDORG00000005774 transcript:ENSDORT00000005776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIV
GVDGAIKALCNRLVVVELNNRTSRDLAEQCVKVLELICTRESGAVFEAGGLNCVLTFIRD
SGHLVHKDTLHSAMAVVSRLCGKMEPQDSSLEICVESLSSLLKHEDHQVSDGALRCFASL
ADRFTRRGVDPAPLAKHGLTEELLSRMAAAGGTVSGPSSACKPGRSTTGAPSTTADSKLS
NQVSTIVSLLSTLCRGSPVVTHDLLRSELPDSIESALQGDERCVLDTMRLVDLLLVLLFE
GRKALPKSSAGSTGRIPGLRRLDSSGERSHRQLIDCIRSIDTDALIDAIDTGAFEVNFMD
DVGQTLLNWASAFGTQEMVEFLCERGADVNRGQRSSSLHYAXXXXXXXXXXTLLRHGANP
DLRDEDGKTPLDKARERGHSEVVAILQSPGDWMCPVNKGDDKKKDTNDERCNELKGDPMA
PIYLKRLLVFAXXXXXXXXXXXXKASLALIRKMIHFCSEALLKEVCDSDVGHNLPTVLVE
ITATVLDQEDDDDGHLLALQIIRDLVDKGGDIFLDQLARLGVISKVSTLAGPSSDDENEE
ESKPEKXXXXXXXXXELQQGKPYHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFIL
DGKLATMYSSGSPEGGSDSSESRSEFLEKLQRARGQVKPSTSSQPILSAPGPTKLTVGNW
SLTCLKEGEIAIHNSDGQQATILKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKR
GRKLKSKLEKTKQKVRTMARDLYDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXINVFKTAFSENEDDESRPAVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILT
RRLRFRLERAPGETALIDRTGRMLKMEPLATVESLEQYLLKMVAKQWYDFDRSSFVFVRK
LREGQNFIFRHQHDFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED
ILSRDNSALNCHSNDDKNAWFAIDLGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQN
WTSLYTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHYLSLSGFEL
YGTVNGVCEDQLGKAAKEAEANLRRQRRLVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQ
GEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGYDPDTVASPKPVSSTVSGT
TQSWSSLVKNNCPDKTSAAAGSSSRKGXXXXXXXXXXXXXXSLGSTKTERRSEIVMEHSI
VSGADVHEPIVVLSSAENVPQTEVGSSSSASTSTLTAETGSENVERKLGPDSSVRTPGES
SAISMGIVSVSSPDVSSVSELTNKEAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPN
LSSRETSSLESFVRRVANIARTNATNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSF
PNLTTPGTTSTVTMSTSSVTSSSNVATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAE
YSLYDFLDSCRASTLLAELDDDEDLPEPDEEDDENEDDNQEDQEYEEVMILRRPSLQRRA
GSRSDVTHHAVTSQLPQVPPGAGSRPIGEQEEEEYETKGGRRRTWDDDYVLKRQFSALVP
AFDPRPGRTNVQQTTDLEIPPPGTPHSELLEEVECTPSPRLALTLKVTGLGTTREVELPL
TNFRSTIFYYVQKLLQLSCNGNVKSDTLRRIWEPTYTXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFCE
HGTKSGLNQGAISSLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYS
RISQEDGDEQPQFIFPPDEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIP
FETRQLYFTCTAFGASRAIVWLQNRREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVP
RGESLMEWAENVMQIHADRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCD
DNFPDDESRQVDLGGGLKPPGYYVQRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCI
QDNRLVDIPISKPFFKLMCMGDIKSNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSV
GSFEEDSKSEFILDPPKPKPPAWFNGILTWEDFELVNPHRARFLKEIKDLAIKRRQILSN
KSLSEDEKNTKLQELVLKNPSGSGPPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEM
ITMDNAEEYVDLMFDFCMHTGIQKQMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSP
SWAAEDIINYTEPKLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANL
HPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN
Download sequence
Identical sequences ENSDORP00000005406 ENSDORP00000005406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]