SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005412 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005412
Domain Number 1 Region: 478-731
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-95
Family PDEase 0.000000893
Further Details:      
 
Domain Number 2 Region: 234-425
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-48
Family GAF domain 0.0000316
Further Details:      
 
Domain Number 3 Region: 77-226
Classification Level Classification E-value
Superfamily GAF domain-like 2.03e-20
Family GAF domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005412   Gene: ENSDORG00000005783   Transcript: ENSDORT00000005783
Sequence length 732
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1821:9116:60898:-1 gene:ENSDORG00000005783 transcript:ENSDORT00000005783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKLEXXXXXXXXXXYQDTNMQG
VVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCVFTPPGMK
EGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPI
VTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFL
LDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGK
PIFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIV
SRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTME
KLSYHSICTAEEWQGLMRFTLPVQLCKEIELXXXXXXXXXXXXXXXXXXXXXXXXGTSCF
DLEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNYELFTDLERKGLLIACLCH
DLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSALSSSEYEQVL
EIIRKAIIATDLALYFGNRKQLEEMHQTGSLNLHNQSHRDRVIGLMMTACDLCSVTKLWP
VTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQ
ILPPTEPLLKAC
Download sequence
Identical sequences ENSDORP00000005412 ENSDORP00000005412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]