SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005413 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005413
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000709
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 59-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000361
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005413   Gene: ENSDORG00000005784   Transcript: ENSDORT00000005784
Sequence length 465
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1254:13978:40856:1 gene:ENSDORG00000005784 transcript:ENSDORT00000005784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQLNPRGALSLLLFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYGVPRWCY
TLNIQDGETTCYSPRGRNYHSSLGTRCEISCYRGFRLIGQRSVKCLPSCRWSGTAYCRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRRCPILKPPQHGYLTCTSAGNNYGATCEYYCDGGYERQG
TPSRVCQSSRQWSGSPPICTPMKINVNVNSAAGLLDQFYEKQRLLIISTPDASNRYYKMQ
ISMLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFQHLTRSYFNMVL
IDKQGIDRERYMEPVTPEEIFTFIDDYLLSNQELTQRKEQRDVCE
Download sequence
Identical sequences ENSDORP00000005413 ENSDORP00000005413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]