SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005414 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005414
Domain Number 1 Region: 56-750
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.33e-238
Family Neutral endopeptidase (neprilysin) 4.41e-17
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005414   Gene: ENSDORG00000005785   Transcript: ENSDORT00000005785
Sequence length 750
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6335:1653:92285:1 gene:ENSDORG00000005785 transcript:ENSDORT00000005785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSESQMDITDLSPPKPKKQQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGVCKSS
DCIKSAARLIQNMDSSAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVVLKD
VLQDSKPEDIVAVQKAKTLYRSCINESAIDSRGGQPLLRLLPEIHGWPAATENWDQTYGS
SWTAEKAIAQLNSKYGKKVLINFFVGTDDKNSNQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVAKLIRQEQGLPVDENQLALEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTVAQLHRNFSLEINGKSFSWSNFTNEIMSTVNVTIPSEEEVVVYAPEYLTKLKPILT
KYSTRDLQNLMAWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
TAVGRLYVEAAFAGDSKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNDNKLNNEYLELNYQEDEYFENIIQNLRFSQSKQLKKLREKVDKDXXXXXXX
XXXXXXXXXXXXXXFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSADNFKAQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYALNSIKTDVHSPGNFRII
GTLQNSAEFAEAFHCRKNSYMNPERKCRVW
Download sequence
Identical sequences ENSDORP00000005414 ENSDORP00000005414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]