SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005421 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005421
Domain Number 1 Region: 139-222
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.02e-24
Family Ribosomal protein L14e 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005421   Gene: ENSDORG00000005793   Transcript: ENSDORT00000005792
Sequence length 285
Comment pep:novel scaffold:dipOrd1:scaffold_31736:7521:11442:-1 gene:ENSDORG00000005793 transcript:ENSDORT00000005792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEKAEPNAKEKPAKKAVADGKVKKATQKAKKPRKGMPHCXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPR
KLLSHGKKPFSQHVRRLRASITPGTILIILTGRHRGKRVVFLKQLGSGLLLVTGPLSLNR
VPLRRTHQKFVIATSTKIDISKVKIPKHLTDDYFKKKKLRKPRHQEGEIFDTEKEKYEVT
EQRKVDQKAVDSQILPKIKAIPQLQGYMRSLFALTNGIYPHKIVF
Download sequence
Identical sequences ENSDORP00000005421 ENSDORP00000005421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]