SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005456 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005456
Domain Number 1 Region: 26-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-47
Family Matrix metalloproteases, catalytic domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 278-350
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.24e-19
Family Hemopexin-like domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005456
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily PGBD-like 0.000377
Family MMP N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005456   Gene: ENSDORG00000005827   Transcript: ENSDORT00000005827
Sequence length 350
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2723:67030:75494:1 gene:ENSDORG00000005827 transcript:ENSDORT00000005827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRYGYLPAPDPGQAQLRSAARLRDALKLMQRFAGLPETGSLDPETIAAMQKPRCSLP
DVLGSAGLVRRRRRYALSGSMWKKRALTWRVQSFPQSSGLSANAVRYLMKNALDVWGVEC
SLTFQEVTSQEPDILIHFARAYHQDSYPFDGQGGTLAHAFFPGEHPISGDTHFDDEETWT
FGSKDDDGIDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPEKYRLSQDDRDGLA
QLYGRASNTPYDRPTRKPLGPPDPPPAPPPDSPSTSVPDRCEGNFDAIANIRGEIFFFKG
PWFWRLQPSGQLVSPRPARLHRFWEGLPAHVRAVQAAYERARDGRILLFS
Download sequence
Identical sequences ENSDORP00000005456 ENSDORP00000005456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]