SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005472 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005472
Domain Number 1 Region: 211-411
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.06e-48
Family Reprolysin-like 0.000000147
Further Details:      
 
Domain Number 2 Region: 428-503
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.7e-21
Family Blood coagulation inhibitor (disintegrin) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005472   Gene: ENSDORG00000005845   Transcript: ENSDORT00000005846
Sequence length 817
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_861:120814:135280:-1 gene:ENSDORG00000005845 transcript:ENSDORT00000005846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRESWRSRGLLVAVVMLLLRLPPLPPRPWPGARALPGNAPGEPVTPYWVLDGPSWHAVT
LEEPILTLDVGMLVLEAEGQELLLELKKNHRLLAPGYTETHYSPDGQPVVLVPNYTDHCH
YYGRVKGYQDSWVVLSGCSGMSGLIMLSSNTSYYLLPWPPGDSKDSSTHMIFRTERLFIW
KGACGSVNQGRTSLPPAPHNREKREAHRKSPMYLELYLVADHTLFMIQHQNLNHTKQRLL
EVANYVDQILRTLDIQVVLTGLEVWTEQDYSQITPDANATLWAFLQWRRELWARRPHDSA
QLLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGAAATVAHEIGHSLGLSHDPD
GCCVEATVAQGGCVMAAATGHPFPRVFSACSRRQLRSFLRKGGGACLSNAPGPGVPAPPA
RCGNGFVESGEECDCGPDQRCPDSCCFAHNCSLRAGARCAHGLCCARCLLKPPGTLCRRA
VGDCDLPEFCTGASPHCPPDIYLLDGSPCAGGRGYCRDGTCPTLDQQCQRLWGPASRPAP
QACFQVVNSAGDTRGNCGQDSAGGFLPCAPRDAQCGKLQCQGGEQSPLVPHMVPLDSTVH
LEGREMACRGALALSDAQLDLFDLGLVEPGTQCGPSMMCQDRRCQNATFQELEHCLITCH
NHGVCNNNHNCHCDQGWAPPFCDRPGFGGSVDSGPMQPEKHDAFLLALLLSFLLPLLPGV
GLAWCCYRLSGLRFQPCFWGCRRKPMGSRSNNVPQREHLPGGVHTMELGPTAAGESQCLE
LKNTPEPSSHPEKPVSVALPSCPPAGQAQRPEFSLWG
Download sequence
Identical sequences ENSDORP00000005472 ENSDORP00000005472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]