SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005511 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005511
Domain Number 1 Region: 26-299
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.28e-77
Family Ankyrin repeat 0.0000000116
Further Details:      
 
Domain Number 2 Region: 365-584
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-25
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005511
Domain Number - Region: 630-678
Classification Level Classification E-value
Superfamily PUG domain-like 0.00536
Family PUG domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005511   Gene: ENSDORG00000005886   Transcript: ENSDORT00000005886
Sequence length 733
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6698:74925:83945:-1 gene:ENSDORG00000005886 transcript:ENSDORT00000005886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRVLSEASKPSSRSDSMAEPRLWVIQAVREEDVDGLRRLLEGGADANESDEWGWTPLH
NAAECGRQDLVELLLRYGAEPARRKRNGATPFIVAGIGGHVHLLRLFLSRGADVNERDSN
GFTAFMEAAWHGRVEALRFLFAQGADVNASRETQEDRRPLRGGGATALMDAAERGHVEVV
RILLEEMGADVNARDNMGRSALIHALLDGGEQAEAVAGLLLDHGADVRVRGEQGKTPLIL
AVEKRRLALVRMLLEQDALEIDDTDHEGTTALRAAVELGSREMVRALCDRGASVSCGDLM
RIARRHYDQALVKLLREYGAQEHVHPPAEDWEPQSSHWGRALKSLHRIYRQPIGKLKIFM
VEEYKIADTSKGGIYLGFYEGREAAVKLFPEGSPEARQEMACLRSCRESSHFVTLYGSES
HRGCVYVCMALCEQTLEERLQGRPEEGLQSREDALAPNTLLSIFEAVRDLHVSHGYTHQD
LQPRNFLIDSKDAVRLADFDQSIKGTGDPQEIRRDLXALGRLVLYVVKKGEIPFETLKGK
NNEEVVQLSPDKETEDLIRHLFYPGENMTDCVGDLLGHPFFWTWENRYRTLRNVGNISDI
KTRKCTSEIYRLLHSDPSVSYSFDKWTSKIDKHVMEKMNKFYAKKNGNVYQDIVGDLLKC
IRNLGEHIDEEQNRKIKETIGDPFCYFQKKFPDLVIYVYNKLKNTEYRKHFPQTNKPAQP
QCVRGVRVGSPEC
Download sequence
Identical sequences ENSDORP00000005511 ENSDORP00000005511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]