SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005590 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005590
Domain Number 1 Region: 235-434
Classification Level Classification E-value
Superfamily MIR domain 8.11e-71
Family MIR domain 0.0000000025
Further Details:      
 
Domain Number 2 Region: 436-601
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.62e-60
Family IP3 receptor type 1 binding core, domain 2 0.0000000192
Further Details:      
 
Domain Number 3 Region: 1132-1288
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.05e-37
Family IP3 receptor type 1 binding core, domain 2 0.0065
Further Details:      
 
Domain Number 4 Region: 107-218
Classification Level Classification E-value
Superfamily MIR domain 9.42e-20
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 514-660,688-792,1293-1337,1477-1510,1605-1693,1969-2079
Classification Level Classification E-value
Superfamily ARM repeat 0.0000163
Family Armadillo repeat 0.077
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005590
Domain Number - Region: 2688-2738
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005590   Gene: ENSDORG00000005966   Transcript: ENSDORT00000005968
Sequence length 2756
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6600:1363:248359:1 gene:ENSDORG00000005966 transcript:ENSDORT00000005968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDQRLHQRIRDCLFKLC
PMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVI
QLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDK
VVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVVR
LFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNS
LFRFKHLATGHYLAAEVDPDFEEECLEFPPSVDPDQDASRSRLRNAQEKMVYSLVSVPEG
NDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTS
PVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLV
YFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEEL
GDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHN
NRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTN
ADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSDKEIRSKSVRELAQDAKE
GQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASF
CRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFVE
EYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVT
TIFPITKIVKGEENKGNNDEEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPE
GNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETS
SGNSSQEGPSSVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDY
PPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELW
VYKGQGPDEPMEGASGENEHKKAEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESA
SVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQ
ALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFL
QTIVKAEGKFIKKCQDMVMAEXXXXXXXXXXXXXXXXXXXXXXXMMRSERDRMDESPLMY
HIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSP
FSDQSTTLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSRAIAIPVD
LDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDR
LRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIK
VLQTLREMMTKDRGYGEKQISIDELDNAELPQTPESENSTEELESSPPLRQLEDHKRGEA
LRQILVNRYYGNIRPSGRRESLTSLGNGPLSPGGPSKPGGGGGGSGSGSMSRGEMSLAEV
QCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEK
FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEIDRDAPSRKKAKEPSPQITEEVRDQ
LLEASAATRKAFSTFRREADPDDHYQPGEGAQAAADKAKDDLEMSAVITIMQPILRFLQL
LCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQ
TLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKL
LLAIMESRHDSENAERILYNMRPKELVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSI
CEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSF
WSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRA
LIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYH
LLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLF
SIVGYLFFKDDFILEVDKLPNETAVPETSESLAREFLYSDVCRVETGENCSSPAPKEALV
VPVEQTEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFF
FMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKE
EHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNE
LRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
Download sequence
Identical sequences ENSDORP00000005590 ENSDORP00000005590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]