SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005663 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005663
Domain Number 1 Region: 356-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005663
Domain Number - Region: 412-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000304
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 464-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000407
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 113-169
Classification Level Classification E-value
Superfamily Sialidases 0.0373
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005663   Gene: ENSDORG00000006051   Transcript: ENSDORT00000006051
Sequence length 535
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4533:9052:295960:1 gene:ENSDORG00000006051 transcript:ENSDORT00000006051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHALWVTVSSVMQRYPLVWGHYDVCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPP
DITCGDPPESFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPK
PLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHM
DPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLD
TTKKLRDFFTVTDLRIRLLRPAIGEIFVDELHLARYFYAISDIKVRGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCECFG
HSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNRFGSI
HDRCNGSGFCECKTGTTGPKCDECLPGNSWHHGCQPNVCDNELLHCQNGGTCHNNVRCLC
PAAYTGILCEKLRCEEAGGCSSDSGQGPTPKGSVALLLPLFLTSLLLGTASSPGF
Download sequence
Identical sequences ENSDORP00000005663 ENSDORP00000005663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]