SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005687 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005687
Domain Number 1 Region: 6-209
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.36e-60
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005687   Gene: ENSDORG00000006075   Transcript: ENSDORT00000006075
Sequence length 273
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5078:31082:33838:-1 gene:ENSDORG00000006075 transcript:ENSDORT00000006075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQEAMSPRACGRPRMRSRMVGGRDALEREWPWQASIQRDGSHFCGGSLLSPRWVLTAAHC
FSNTSDTAPYRVLLGARQLLRPGPRAVYARVRRVESNPLYRGMASSADVALVELEAPVAF
SDHILPVCLPDPSVSFAPGMSCWVTGWGSPSEQDRLPSPRTLQKLSVPLIDTPKCNLLYR
TDAEPDSQPKAIQDDMLCAGFAEGKDACKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRVTSHLRWIRHIIPELQFQGRAGGRRR
Download sequence
Identical sequences ENSDORP00000005687 ENSDORP00000005687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]