SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005726 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005726
Domain Number 1 Region: 282-442
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-29
Family SPRY domain 0.0000979
Further Details:      
 
Domain Number 2 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000134
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 9-64
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000571
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005726   Gene: ENSDORG00000006117   Transcript: ENSDORT00000006117
Sequence length 466
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_7641:25870:36356:-1 gene:ENSDORG00000006117 transcript:ENSDORT00000006117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAPGERLREEARCSVCLDFLQDPISVDCGHSFCLXXXXXFCEKSESAQGGVYACPQC
RSSKPSSFRLNQLGSVDSVRQLGLGLGAGASRARQCSWHREDLSRFCEEDQVALCWVCDT
TPEHRGHSTMPLQEAARCYQVKLEIALEHVRKEMEEALTQEVNVGKKTVIWKEKVESQRQ
RFRLEFEKHRGFLAQEEQLQLRRLEEEERATLQKLRDSKSQLVQQNKVLKELVEELEQRC
QQPALSLLEGVRDTLSRSSAVIRLEPETISMELKTVCCIPGMREMLRKFQVDVKLDLTAH
PSLLTTDRSVRDGELWKVPSSRFDTGLCLLTFSSGTYVGEKEQWDNWQNRKEESTSPEHG
VWAVWLLKGNEYMVLASPSVPLLQLEQPRCVGIFLDYEAGEISFYNVTDGSHIYTFNQVF
SGVLRPYFFICDMAPLFLPPMTEGEAGDWAARGFLGLASSVGDALP
Download sequence
Identical sequences ENSDORP00000005726 ENSDORP00000005726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]