SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005751 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005751
Domain Number 1 Region: 121-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000243
Family Complement control module/SCR domain 0.0000879
Further Details:      
 
Domain Number 2 Region: 23-80
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000162
Family Complement control module/SCR domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005751   Gene: ENSDORG00000006143   Transcript: ENSDORT00000006143
Sequence length 239
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2899:4814:32828:-1 gene:ENSDORG00000006143 transcript:ENSDORT00000006143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSLLMWGLCVSLMVPSCLTELCDSDPPHVSHAAFKALTYNKGTMLNCDCKAGFRRVSY
GSSYMTCSENSSWDNRCQCVRISNHVPKKQVTPQPEEQKERKTTETQAQMQSMYHMNLKD
YCVEPPRWKHEGQKRIYHFVVGQTVHYQCIEGYKALQRSPATSICKMICGKTRWSQPQLT
CINESQQHPFPGEEAPQLSTDALLETEPSCLLTTTDPQSPTEAARTVETFILTMEYHVA
Download sequence
Identical sequences ENSDORP00000005751 ENSDORP00000005751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]