SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005783 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005783
Domain Number 1 Region: 180-301
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-19
Family Leukotriene A4 hydrolase catalytic domain 0.016
Further Details:      
 
Domain Number 2 Region: 7-34
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.000000379
Family Leukotriene A4 hydrolase N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 90-140
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000806
Family Leukotriene A4 hydrolase catalytic domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005783   Gene: ENSDORG00000006174   Transcript: ENSDORT00000006176
Sequence length 710
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5416:446:27607:1 gene:ENSDORG00000006174 transcript:ENSDORT00000006176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSEMVDQDGSRWTVTTFHTTPPMPTYLVAFVVCDFDRVSRTERGKEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVALPVFDARAMENWGLLMFDEALLLLPPSQ
DLAEKKTLISYIVSHEVGHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNE
LFFSNLLYGVLREDHALESRAVLVKGENFTGTNEIVGLFDLFTYYKGASLVRMLSCFLNE
QLFIGSLTSYLEAFSYSNAEQDDLWSHFQMAIDNQTVALPATVKAIMDTWTQQSGFPVVT
LNASTGAVTQEPFYLEKAENRTLLAHNGTWIVPIGWMRSGKAQSLVWLEKDSXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAIPVIHRLQLLGDAFFLSKNN
YVEIETALDLTKYLAEEDEIIVWNEVLVNLDTRHLVSDANNYDSYLLLKKYLLKRLHPIW
EVYSAIIREDPAALEDDFLALLSLEKLFRTACWLGLEDCLQLSREFFRKWMSHGDNGIPR
LIRDAVLCYGVARGGDKEWDFLFRVYENTTSEDDRLPLAYALSCSRDPWTLNRFMEHAIT
GSPFTATDTNILEIVAGSEVGLYVAKDFLLSHRQAVVERYGTESLETLLYVLARTLSTDL
QVAELQRAFGSMLSEDQSMAVHARLQMIKKENLKSRERGARIAAWLRRNA
Download sequence
Identical sequences ENSDORP00000005783 ENSDORP00000005783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]