SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005805 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005805
Domain Number 1 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 5.89e-23
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 2 Region: 82-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000198
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 279-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000142
Family SPRY domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005805   Gene: ENSDORG00000006201   Transcript: ENSDORT00000006201
Sequence length 315
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4136:5:7990:-1 gene:ENSDORG00000006201 transcript:ENSDORT00000006201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLSANLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECREPS
PQRNLRPNRPLAKMAELARRLQPPSPVPQGVCAAHREPLAAFCGEELRLLCAACERSGEH
WAHRVRPLPEAADELKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDIKEALRRAQDVKLQPPEVVPMELRTVCRVPGLVETLQRFHVDVTLDPDTANPEL
VLCEDRRSVQRGEQR
Download sequence
Identical sequences ENSDORP00000005805 ENSDORP00000005805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]