SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005830 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005830
Domain Number 1 Region: 1000-1149
Classification Level Classification E-value
Superfamily CalX-like 3.01e-31
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 2 Region: 2224-2377
Classification Level Classification E-value
Superfamily CalX-like 5.62e-30
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 3 Region: 2953-3083
Classification Level Classification E-value
Superfamily CalX-like 6.28e-29
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 4 Region: 2591-2709
Classification Level Classification E-value
Superfamily CalX-like 1.31e-28
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 5 Region: 3925-4061
Classification Level Classification E-value
Superfamily CalX-like 2.88e-28
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 6 Region: 4255-4399
Classification Level Classification E-value
Superfamily CalX-like 1.83e-26
Family CalX-beta domain 0.00083
Further Details:      
 
Domain Number 7 Region: 1724-1810,1837-1869
Classification Level Classification E-value
Superfamily CalX-like 3.79e-26
Family CalX-beta domain 0.00056
Further Details:      
 
Domain Number 8 Region: 150-289
Classification Level Classification E-value
Superfamily CalX-like 1.2e-25
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 9 Region: 4399-4541
Classification Level Classification E-value
Superfamily CalX-like 3.27e-25
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 10 Region: 1985-2129
Classification Level Classification E-value
Superfamily CalX-like 2.49e-21
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 11 Region: 4991-5119
Classification Level Classification E-value
Superfamily CalX-like 2.49e-21
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 12 Region: 1115-1279
Classification Level Classification E-value
Superfamily CalX-like 7.06e-21
Family CalX-beta domain 0.0049
Further Details:      
 
Domain Number 13 Region: 1581-1700
Classification Level Classification E-value
Superfamily CalX-like 1.15e-20
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 14 Region: 1859-1982
Classification Level Classification E-value
Superfamily CalX-like 3.14e-20
Family CalX-beta domain 0.0033
Further Details:      
 
Domain Number 15 Region: 4041-4179
Classification Level Classification E-value
Superfamily CalX-like 1.06e-19
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 16 Region: 409-549
Classification Level Classification E-value
Superfamily CalX-like 1.83e-19
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 17 Region: 3081-3197
Classification Level Classification E-value
Superfamily CalX-like 3.66e-19
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 18 Region: 3660-3804
Classification Level Classification E-value
Superfamily CalX-like 1.57e-18
Family CalX-beta domain 0.0072
Further Details:      
 
Domain Number 19 Region: 2115-2240
Classification Level Classification E-value
Superfamily CalX-like 3.66e-18
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 20 Region: 899-1001
Classification Level Classification E-value
Superfamily CalX-like 7.06e-18
Family CalX-beta domain 0.0056
Further Details:      
 
Domain Number 21 Region: 5208-5364
Classification Level Classification E-value
Superfamily CalX-like 1.31e-17
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 22 Region: 2341-2386,2488-2566
Classification Level Classification E-value
Superfamily CalX-like 3.79e-17
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 23 Region: 4161-4265
Classification Level Classification E-value
Superfamily CalX-like 2.88e-16
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 24 Region: 1306-1449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000124
Family Clostridium neurotoxins, the second last domain 0.081
Further Details:      
 
Domain Number 25 Region: 5486-5633
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000968
Family CalX-beta domain 0.0033
Further Details:      
 
Domain Number 26 Region: 36-154
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000144
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 27 Region: 298-397
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000379
Family CalX-beta domain 0.0075
Further Details:      
 
Domain Number 28 Region: 4526-4671
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000122
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 29 Region: 3765-3901
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000876
Family CalX-beta domain 0.0051
Further Details:      
 
Domain Number 30 Region: 658-747
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000196
Family CalX-beta domain 0.0081
Further Details:      
 
Domain Number 31 Region: 5380-5495
Classification Level Classification E-value
Superfamily CalX-like 0.0000000693
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 32 Region: 850-924
Classification Level Classification E-value
Superfamily CalX-like 0.000000131
Family CalX-beta domain 0.018
Further Details:      
 
Domain Number 33 Region: 4751-4858
Classification Level Classification E-value
Superfamily CalX-like 0.00000131
Family CalX-beta domain 0.0096
Further Details:      
 
Domain Number 34 Region: 513-628
Classification Level Classification E-value
Superfamily CalX-like 0.0000353
Family CalX-beta domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005830
Domain Number - Region: 2815-2950
Classification Level Classification E-value
Superfamily CalX-like 0.000279
Family CalX-beta domain 0.011
Further Details:      
 
Domain Number - Region: 3202-3249
Classification Level Classification E-value
Superfamily CalX-like 0.00209
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number - Region: 4892-4972
Classification Level Classification E-value
Superfamily CalX-like 0.0144
Family CalX-beta domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005830   Gene: ENSDORG00000006226   Transcript: ENSDORT00000006228
Sequence length 6296
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4750:30322:375592:1 gene:ENSDORG00000006226 transcript:ENSDORT00000006228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIVLGMPSASLLVNLLSALLIPFVLGETEIQFAGQTEFVVNETSTTVIRLVIERVGKPA
NITAIVSLHGEDTRDFFDTYAAAFIPVGETNRTVYIAVCDDDLPEPDETFIFHLTLQKPS
ANVKLGWPRTVTVTVLSNDNAFGIISXXXPSPVTVSEPRGRNESVPLILIREKGTYGMVT
VTFEIEDGPNAPDEDLSPVRGNITFPPGRATVIYNLTVLDDEVPENDEIFLIHLKKVEGG
AEINITRNSVEIIIKKNDGPVRFIQSVYLVPEENHILSIPVVRGKDSNGNLIGSDEYEVS
MQYTVLTGNSTVHAQQNLDFIDLQPNTTVVFPPFIYEAHLQFQIIDDTIPEISESFHIML
LKSTLQGDAVLTGPQSIQVTIKPNDKPYGVLSFNSILFEKAIVINEDTISRFEEITVVRN
GGTHGNVSVSWVLTRNSSDPSPVTADIRPSSGLLHFAQGQMLASIPLAVVHDEFAEEAEA
FLLKILPHTIQGGAEVSEPAELLFYLQDSDDVYGLITFFPMENQKIESSPEERYLSLSFT
RLGGTKGDVRMLYSALYIPTGAVDPLRGKDGILNTSRRNYLIFPEHKTQIATKLPIRNDA
FLQNGAHFLVQLETAVLMNIFPPIPPISPRFGQIRNITLLVTPAIANGEIGFISNLPIIL
HEPEESTAEMVYIPLHRDGTDGQATVYWSLKPSAFNSKVVTMDDLDPFNGSVVFLSGQSD
TTINITVKGDDIPEMNETLTLSLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLDEHYWVVLSSHGERESKLGSMTVVNITILKNDDPHGIIEFVSDGITVMIN
ESKGDDTYSAIYGVVRNQGNFGDVNISWVVSPDFTHDVFPVQGTIFFGDQEFSKNITVCS
LPDEIPEEMEEFTIILLNATGGAQVGNRRTATLRIGGNDDPIYFAEPRVVRVQEGETANF
TVLRNGSVDVTCTVQYATRDGKATEKEGDFVLAGKGGVLTFEPGSREQSLSVYINEDGIP
ETEEPFYIMLFNSTGDTVIYQYGIATVIIEANDDPNGIFSLEPIDKTVEEGKTNAFWILR
DRGHFGDVSLAWQLFQNDSVLHPGQEFYETSGTVNIMDGEGAKPIIIHAFPDKIPEFNEF
YILKLVNISGGSPGPGGQLAEANLQVIVMIPFNDDPFGIFILEPECLEREVAEDFLSEDD
LSYITNFTVLRQQGIFGDVRVGWEILSRAFTAGLPPMIDFLLVGIFPSTVPSQPHMRRHH
SGTDALYFSGLEGAFGTVNPKYHPSRNSTIANFTFSAWVMPNANTSGFILAKDDGNGGIY
YGVKIQTNESHVTLALHYKTSGSNATYIAKTTVMKYLEEGIWLHLLIILDDGIIEFYMDG
NAMPKGIKSLKGEAITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTVEEGATVSCVVERTRGALGSVHVFYTISQIQSGGSDY
LVDDFTNASGNITFLPWQRSEVLNLHVLDDDIPELNEYFQVTLVSAVPGDGKLGSTPTSG
ASIDPEKETTDITIKASDHPYGLLQFSTGLPPQPEDAMSRPASSMPQLTVQEEDGAVRLL
VVRTLGLLGRVTAEYRTLSLTAFSPQDYQSVDGTLEFQPGERYKYIFVNITDNSVPELEK
SFKVELLNLEGGAELFRVDGSGSGDGDLEFFIPPIHRRASLGVASQILVTIAASDHAHGV
FQFSPESLSVNGTEPEDGHSTVLLTVQRSHGALSQVTLHWNIDSDPDGDLALTYGNTTFE
IGEMKAHITVEILPDDIPELDKAFSVSILRVSSGSLGVLTNATLIVLASDDPYGVFIFSE
ENKPTKIEEATQNITLSITRLKGLMGEVIVSYATLDDMERPPYFPPNLARATQGKDYTSA
SGFAVFKANQSEATITISILDDEEPERSESVFIELLNCTLLEKVQNRPIQDSPRLGPKAE
TIAHVIIIANDDAFGTLQLSAPLVHVAENHIGPIVVTTRAFADVSVKFAVPXXXXXXEDY
SIASSDVVLLEGETSKAVPIYIINDIYPELEETFLVQLLNETTGGAKLGAVTETVIIIEA
SDDPYGLFEFQITKLIVEESEFNSVKVNLPIIRNSGTLGNVTVQWVATINGQLATGDLRV
VSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTIGLYRVASIVIPANDN
PYGTVAFVQSVYRIQEPLERSSHANVTVRRSGGHFGRLLLFYSTSDIDVVALAVEEGQDL
LSYYESPTQGVPDLLWRTWVNISTLGKPQDTCATLCLREHACSAFSFSSASEGPQCFWMT
SWVSLTVNNSDFWTYKKNMSRVASLFSGQAVAGTDYEPMTRQWAVMLEGDEFANLTVSIL
PDDFPEMDESFLISLLEVHLINTTASFKNQPTIGQPNTSAVVIALNGDAFGVFVIYSISP
NTSEDGFFVEVQEQPQTSVEFVIHRTGGSLGQVTVEWRVVGGTATEGLDFIGAGDFLTFA
EGETKRTVTLTILDDSEPEDEESIIVRLVHTEGGSRILPSSDTITVNILANDNVAGIVSF
QTASRSVIGHEXXXXXXXXXXXXPGRGNVTVDWKIIGQNLELNFANFTGQLFFPEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPPAGIALLDTQGYAAVLTVEASDEPHGVLN
FAPSSRFVLLQEANVTIQLFVNREFGSLGAVNVTYATVPGMLSLKNQTEGNLAXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDDVSELEEYFLVNLTCVELIMTPLTSFPPRLDSEGLT
AQIIIDANDGARGIIEWQHSRFEVSETYGSLTLVAQRGRGASGQVSLFVYAQNLEAQLGL
DYIFTPMILHFADRERSKTVDILILDDGIPEGDEKFQLILTNPSPGLELGENTIALITIL
ANDDGPGVVSFNNSEHFFLREPVAVHVQESVAVLYIVREPAQGLFGTVTVQFMVTDVNSS
VESKDLTPSRGFIVLEEGVRFKTLHISAILDTEPEMDEHFVCTLFNPTGGARLGTRVQTL
ITVLQNQAPLGLFSILAVGNRASSIDVEESNRTVYLNVSRANGIDLAVSVQWETIPETAF
GTRGMDSVFSTFQSFLNKSSSGWCFFALEDLTYGIMLRKSSLTVYRWQGIFIPVVDLNIE
NPESCEAFIIGLSPYIVVTHEERNGERPSASSVYAFTSEFKLFLVQTIIIPRSSQVRHFT
SDTQDYLIIASPKVDSEFTQVFKWNGRFTFHEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQNLVDIFIWEM
GQSSFRHFQFLDFSPVERIHSFIPASGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSLYKQVEEL
EQDSLVTLNIERLKGTYGRITVAWEADGNINDIFPTSGVISFTEGQMLSTVTLTVLADDL
PELSEVVTVTLTGVTTEGVEDQTKGAMIDQKRKKSVITTLPNDSPHGVVGWHANSLFTRV
TEPIENITVLQLRVARDRGLQGDIAIHLMATPNFLLHTNHQATENEDYVLQETIIIMKEN
MKETHAKVAILPDDTPELEEGFIVIITDVSLVNSDLSAEQPRVQKPRMEIAEILIEENDD
PRGILKFHVNRDIDGVITAYEEPPPFNVLRVPVIRLAGSYGSLNVYWEATPDSASLEDFK
PSHGTLEFAEGQVTAMIEITIVDDAEFELRELFSISLTSVAGGGRLGEDIVVMVAIPQND
SPFGIFGFEEKTVIDESLWSDDPDSYVTLTVVRSPGGKGAVRLRWIVDEKAKDDLHPLNG
TLDFDEAESQKTIVLHTLQDASLEEDRRFTIQLVSVDEVEISPIKGSASIIIRSDKGASG
EVGIAPSSRHILIGEPSAKYNGTAYISLVRGPGSLGEVTVFWKIFPPTVGDFLETAGKLT
LQDGQSVATVAIQTLDDDIPEEKRSYEFRLMANEGAELSVTSHSANITMVASDSPYGQFA
FAQEQLQVSEETQEVNITVVRSAGHFGLVVLTYETVSRTAEAGLDFVPMSGELVFEAREV
AKSLRVAILDDDQPEGPEDFSLTITKVDLQGSGYDFTIQENGLQLDQPPELGTISTVQII
ILQNDNVEGIIEFDPKYTAFEVEEDVGMVAIPVRRLRGTYGRVTADFISQSASALPGGVD
YTLHGSSATFQHGQNLSFIHVSITDDDESEFEEAIEILLTGATGGAVLGRHLVSKITIAE
SDSSFGIVRFLNQSKISIPNSNSTMILSLMLERTAGLLGNIQVNWEIVRPDSEEGLLLQS
GDFAEPVNGTFYFEEGEGGVRTIILTVYPHDEIEVEKTFTIQLTVVKGKATLDSRAKDVT
LTIQKFGDPNGIVHFAPVSLSKKIYTEPLAEDGPLVITLFVKRVQGTLGEIKIYWELSSD
FDITGDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSANDDPHGVFALRPNHQSLIGKNFIRSIQINVTRLAGTFGDVAVIFRISSDDKEE
VIAPENMEGQLVVRDGTRYKVDTVPIKSQIFLSLGSNFTLHLEAVMLVSGRVYGMPTILQ
EAKSAGLPIPEEAANSQVGFEFTAFPLMDIATGTSQVTVSRRGTYGPLSVAWTSGYAPGV
EIPELVVVGNMTPVLGSLSFSHGERSKGVVLRTFPHPGRPEAFVLHLSGVQSRVPGGAQL
RSGFTTVEIEPMGIFQFSPSSRSITVSEDTQIIRLHVQRLFGFHSDLIKVSYETKAGSAK
PLEDFEPVQKGEVFFQKFQPEVDFEITIINDQIPETEEEFYVNLTSVEITGLRKFGVNWR
PRLNLNLSVAVITILDNDDIMGTDISVPTAAANPTTLIPVETGSITYPGTDRVTAIQHTT
EIVVIVTEAINESITPEKIVTLPGPSAMPEKPDATIGMENAFDTFMHGTFSLSPPIVYVD
EEMKNGTFSAAEVLIQRAGGFTGNVSITVKTFGKRCAGEDPNMLPFQDDYGVANLTWAVE
EEDFEEQELSFTFLDGEREHRVSIPILDDDEPEGQEFFYVFLADPQGGAQVAKGRDDAGF
AAFSMVIISESDLHNGILGFSEESQRGLELGEGAAERRQHLVVTRQPNRAYEDVQVFWRV
TFNKTAIILQKEEANLMDELLFVSGTTTCIMGQTQCLITLELKQEKIPQVEMDFFVELYE
VTSGAAINNSARFAQIKVLQHDEPRSLMYFSVGSRLAVAQRNATLISLQVSRDSGTQSMM
SVSFSTQELRSAETIGRTLLSPAVPGKDFVKTEGTLVFEPGQRNVMLDVILTPDTSSLSP
FPKRFQIVLFDPKGGARIDHAYGLANITLVSDADSQAMWELEDQLHQPLDEVILNRVLHD
ISLNVATESTDEQLSAVLHLIEKISVEGKSQAFSMEIRTLFYDILCALVNPKRKDTRGFS
HFADVTESFAFSLLTDVTCGSPGEKSKTILNSCPYLSILALHWYPQQINGHKFEGKEGDY
IRLPERLLDVADTDIMAGKSTCKFIQFMEYSSQQWFVTENNLPALKNKVLSVNVKGQSSP
LLSNNNEVRYRIYAAEQRLIPETALCLLWNRAAASWLSDSQLCRVVEDASDHVECACSHM
SLYAVYSQTDNLSSYNEAFFSSGFICISGLCLAVLSHVFCARCSMFAAKLLTHMMAASLG
TQIVFLASAYASPQLTEESCAAIAAVTHYLYLCQFSWMLIQSVNFWYVLVMNDEHTERRY
LLFFLLSWGLPSLVVILLIIILRGIYHQNMPQIYGLVHGDLCFIPNTYAALFTAALVPLM
CLVVVFVVFIHAYQLKPQWKAYDDIFRGRTNAAEIPLILYLFALISMTWLWGGLHMAYRH
FWMLVLFVIFNSLQGLYVFVVYFILHNQMCCPVKASYTVEMNGHPGPSTAFFTPGSGMPP
TGEEINKSTQNLISAMEEVPPDWERASFQQASQASPDLKTSPQNGASFPSSGAYGQGSLX
XXXXXXXXXXXXXXXXXXAGLSVSDNESGQGSQEGGTLTDSQIVELRRIPIADTHL
Download sequence
Identical sequences ENSDORP00000005830 ENSDORP00000005830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]