SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005903 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005903
Domain Number 1 Region: 231-388
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-16
Family Ankyrin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005903   Gene: ENSDORG00000006308   Transcript: ENSDORT00000006308
Sequence length 869
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3311:69683:88589:-1 gene:ENSDORG00000006308 transcript:ENSDORT00000006308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEGPRGGPGEVAEAPGDESGAPGGEAFPLSSLANLFEGDEGSPSPSPADTAARPAGPG
DARTNLRMKFQGAFRKGVPNPIDLLESTLYEASVPGPKKAPMDSLFDYGTYRHHPSDNKR
WRRKVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQTAL
HIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHIVN
YLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDSNL
EAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWVYGPVYSSLYDLS
SLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLCAM
VIFTLTAYYQPLEGTPPYPYHTTADYLRMAGEILTLFTGVLFFFTNIKDLFMKKCPGVNS
LFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTY
SIMIQKXXXXXXXXXXXXXXXXXXXXXXXLVSLLNPCANMKVCNEDXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRWSSVVPRVVELNKNPSPDEVV
VPLDNMGNPNSDGHQQSYPPRWRTEDAPL
Download sequence
Identical sequences ENSDORP00000005903 ENSDORP00000005903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]