SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005919 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005919
Domain Number 1 Region: 10-242
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.04e-83
Family Eukaryotic proteases 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005919   Gene: ENSDORG00000006322   Transcript: ENSDORT00000006324
Sequence length 244
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6844:14290:15856:1 gene:ENSDORG00000006322 transcript:ENSDORT00000006324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGIPANPPEVSGLSRVVNGEDAVPGSWPWQVSLQYEGFHFCGGALISEEWVVTAAHCGVT
TDDKVVAGAFNLDPDEEGVQVLDIAEVINNPNASIQPVYNDIALLKLDTPARFTDTVSAV
CLACDEADFPPGTPCVITGWGQTQYDAFQTINTLQQAVLPLVSTPDCQEIWGDQVTDDMI
CAGSNGTSPCMGDSGGPLVCKKGGVWSQVGIVSWGSGFCPGDTPAVFTRITAVLDWVKRT
LAEN
Download sequence
Identical sequences ENSDORP00000005919 ENSDORP00000005919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]