SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005929 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005929
Domain Number 1 Region: 135-228
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-23
Family Eukaryotic proteases 0.00021
Further Details:      
 
Domain Number 2 Region: 5-52
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000028
Family Eukaryotic proteases 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005929   Gene: ENSDORG00000006334   Transcript: ENSDORT00000006334
Sequence length 230
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5067:6497:9721:-1 gene:ENSDORG00000006334 transcript:ENSDORT00000006334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAEEQDKVVHGSPYHLDAHPFQAALFTSGHLFCGGVLVDRQWVLTAAHCKKPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXVFPDTINCAEVHLVPKTDCEGAYPGHFTRTMVCASSDQEGADSCQ
GDSEGPLICDNHLRGIMAWGDSPSGSKNKLGVYTDICMHLQWVKNVIARW
Download sequence
Identical sequences ENSDORP00000005929 ENSDORP00000005929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]