SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006003 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006003
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-52
Family Inorganic pyrophosphatase 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006003   Gene: ENSDORG00000006412   Transcript: ENSDORT00000006412
Sequence length 170
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5787:5949:27959:-1 gene:ENSDORG00000006412 transcript:ENSDORT00000006412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSSEERAAPFTLEYRVFLKNEKGQYISPFHDIPIYADKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINMDDPDAANYN
Download sequence
Identical sequences ENSDORP00000006003 ENSDORP00000006003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]