SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006032 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006032
Domain Number 1 Region: 65-213
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.03e-43
Family Dual specificity phosphatase-like 0.000000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006032   Gene: ENSDORG00000006443   Transcript: ENSDORT00000006442
Sequence length 242
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4723:1229:2806:-1 gene:ENSDORG00000006443 transcript:ENSDORT00000006442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFNKFQNEYSEHCETNVDSSSSPSGSPPTSVLGLGGLRISSDCSDGESDRELPSSATESD
GSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTY
KQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLS
LNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHAPSEQLYFSTPTNHNLFPL
NT
Download sequence
Identical sequences ENSDORP00000006032 ENSDORP00000006032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]