SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006042 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006042
Domain Number 1 Region: 38-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-32
Family Laminin G-like module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006042   Gene: ENSDORG00000006446   Transcript: ENSDORT00000006452
Sequence length 1070
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_746:2022:159611:1 gene:ENSDORG00000006446 transcript:ENSDORT00000006452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTCPALKTEGYQFMQTSRKELNASGFDVGARFSLRRASCEGGKSCFRLGRALLIRETFKV
FPEGLPEEYAVAAVFRVRRNTRKERWFLWQILNQQNVPQISITVDGGKKVLEFMFRAAEG
DTLNYVFKNRELRPLFDRQWHKLGISVQPRTISVYVDCSLVASRQTSVQATTDPRGRTAI
ASRASDGRPVDIELHQLVIHCDTDFLARDLCCRDPAACSEQAEFGNPVASSVMAHAGKSP
PNLLKQELRNLCHCVPEQGEAGLPAPTGSPGQKGEKGEPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXGELGAKGDPGVPGFNGQEGSKGDVGPVGPPGPKGEKGDMGPPGLPALTVSE
GLRGPQGPPGEEGQRGRRGKTGPPGKPGPPGPPGPPGLQGIQQTFGSYFNKXXXXXXXXX
XXXXXGETGLPGFLGSKGQKGEPGAPGADGSPGMKGELGDTGPPGWPGSPGLKXXXXXXX
XXXXXGPRGDVGLLGEPGTPGKQGDKGEKGDAGGATGPPGLPGPKGEAGPPGRSLLGEPG
LDGRPGVPGPRGPKGERGLPGIHGSPGDVGPPGVGIPGRMGSPGPAGEPGVQGPRGLPGL
PGAPGNHGAPGRDGNPGPPGPPGEPVALPLLGDVGALLKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSKGERGYPGAPGEKGDEGLQGSPGTPG
TPGPAGPPGSEGPPGIPGPPGPPGPPGVYFSDSNGMGSLYKIQGGVNVPSFPGPPGPPGP
KGDLGPVGEPGAMGLPGLEGFPGAKGDRGPAGPPGTAGASXXXXXXXXXXXXXXXGQRGP
MGDVGFPGPEGPVGKPGMNGKDGLPGAQGITGKPGDRGPKGERGDQGIPGDRGPQGEQGK
PGLAGTKGALGPVGPPGDKGSAGPPGHRGPPGSPGTPADAVSFEEIKKYVHQEVLRVFEE
RMAVILSQLQQPAAMLAGHAHGRPGPPGKDGLPGPPGDPGPQGYRGQKGERGEPGIGLPG
SPGLPGSSALGQPGLPGAPGPQGPPGPSGRCSPEDCLSPHGRPHWTGRTW
Download sequence
Identical sequences ENSDORP00000006042 ENSDORP00000006042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]