SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006078 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006078
Domain Number 1 Region: 494-609
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-26
Family Calponin-homology domain, CH-domain 0.00043
Further Details:      
 
Domain Number 2 Region: 85-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 720-750
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000428
Family LIM domain 0.00083
Further Details:      
 
Domain Number 4 Region: 687-719
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000967
Family LIM domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006078   Gene: ENSDORG00000006489   Transcript: ENSDORT00000006491
Sequence length 1052
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6572:51542:64723:-1 gene:ENSDORG00000006489 transcript:ENSDORT00000006491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQGLCGALGLEPGGGLPQYYKIKAQLNYWSA
KSLWAKLDKRAGQPVYEQGQACASTKCLVVGAGPCGLRAAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVT
FTGLQPPPRKRSGWRAQLQPSPPAQLANYEFDVLISAAGGKFVPEGFTVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQKFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPETDRLLESANVVPEALQRFARAAADFATHGKLGKLEFAQDARGRPD
VSAFDFTSMMRADSSARVQEKHGARLLLGLVGDCLVEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXESLYQLLSQTSPENMHRNVTYRLDPTRYPLNLRAVTPNQVRDLY
DVMAKEQVQKKSDKTDAEVSATGSAGTQEELLHWCQEQTAGYPGVHVTDLSSSWTDGLAL
CALVHRLQPGLLEPSELQGMGAVEVTTWALRVAEHELGIAPVLSAQAVVAGSDPLGLIAY
LSHFHSAFKSMDRSPGPVRQVCPGASNAVLFLGKLQRTLQRTRAKENGEDAGGKKPRLQV
EAESPNTEEPQVPEPSVPLTPPSQHQESGAGDLCALCGRHLYILERFCADGHFFHRSCFR
CHVCEATLWPGGYGQHPDGHFYCLQHLPQPGHKEDEIDEIDGGPKSPKLSTPEEDSTSPA
LPVSSPKQPTRRRIRLSSPERLQLASLNITPDPETEPPPKPPRSCLALAQQALQSSFVGW
GMSVQVPQAMEEEEERLSSNDEDEEDVPFDTNLEQALLTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPEQQKKFWVEQLLQ
LVQRKNSLVAEEAELMITVQELDLEEKQRHLDQELRCYINREETMKTDDDRQAEDQVLRK
LLDVVNQRDALIRFQEERRLSELVLGTVAHAY
Download sequence
Identical sequences ENSDORP00000006078 ENSDORP00000006078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]