SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006081 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006081
Domain Number 1 Region: 72-116,165-289
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.28e-17
Family Nucleotide and nucleoside kinases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006081   Gene: ENSDORG00000006494   Transcript: ENSDORT00000006494
Sequence length 292
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6572:112541:126446:-1 gene:ENSDORG00000006494 transcript:ENSDORT00000006494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKEKKRHLGDTRHFCPVALKENFILQPGSTDEAVKYRDKIYYFSTVEAKEKFLEHPYEYV
AHGQPLKAPPIRICLLGPRGSGKTVHARYLAKKFGIFHIQFDEFLQEKMLLKTERKFGPD
YEDDSEEEQVTKQELEELAIQANVKFEEETTKKRPLDVKFTEEEEAIKASLVENEPLPPE
ILNMILSEWWLKEPIRSTGFVLDGFPRYLDEVLYLEERGFFPDVAVLIHVEDQDISDRLL
PFQIAKWKAKQQKKIGRRKLIKDMKTKIRDDMIAKRRAELISEREKRRKLEV
Download sequence
Identical sequences ENSDORP00000006081 ENSDORP00000006081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]