SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006091 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006091
Domain Number 1 Region: 143-447
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.01e-117
Family Transglutaminase core 0.00000000697
Further Details:      
 
Domain Number 2 Region: 3-142
Classification Level Classification E-value
Superfamily E set domains 7.7e-41
Family Transglutaminase N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 560-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000445
Family Transglutaminase, two C-terminal domains 0.0029
Further Details:      
 
Domain Number 4 Region: 612-666
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000576
Family Transglutaminase, two C-terminal domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006091   Gene: ENSDORG00000006504   Transcript: ENSDORT00000006504
Sequence length 669
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5017:910:31052:1 gene:ENSDORG00000006504 transcript:ENSDORT00000006504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIRVTKVDWQRSGNGAAHHTQEYPCPELVVRRGQLFKLTLDLSGDLDSEEALVFTVET
GPQASEALHTKAMFQTAELEVGDTWTAAKGEQTGNTMTVSLASPPNAVIGRYLLSARPSS
RRKHSDRKLGEFILLFNPWCPEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILDICLSILDRSPSHQNDPATDVSHRHDPVYVTRIISAMVNSNNDRGVVQGQWQG
KYGSGTSPLHWRGSAILQKWFKGKYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSA
HDTDKNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGSSYNGWQVLDATPQE
ESEGVFQCGPASVTAIREGDVHLAHDSPFVFAEVNADYITWLWHEDDEKRERVYSDTKKI
GRCISTKAVGSDNRVDITSLYKYPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKKIPVAISYSQYKEDLTDDKKILLAAMCFVTKGEKLLVEK
DITLEDFITIKVLGPAVVGVPILEPQERALVQFNITPSKSGPRQLQVDLVSPHFPDIKGF
VIVHVATAK
Download sequence
Identical sequences ENSDORP00000006091 ENSDORP00000006091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]