SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006166 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006166
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily DNA clamp 0.0000144
Family DNA polymerase processivity factor 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006166   Gene: ENSDORG00000006582   Transcript: ENSDORT00000006583
Sequence length 279
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3053:8099:23034:-1 gene:ENSDORG00000006582 transcript:ENSDORT00000006583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFNAEIVDKHSLDDFKRVINMLTNLAKGCILHICPDKLNFILLGSPESGGASLWCELPQ
ENFFSTFQMQGISAEYNEIYLQVQLENITRVVNTPHSTETLRIKFINKYSGILKFCIKQL
PESNRSRTMTYYFPIVVIPTNFWNELQEPIVPDLDVSIYLPVLKTMKNIVEKMKNISNHL
VIEANLNGELNLKIETELVCVTTHFKGLGNPPLASQSCRDRSPGELTEVHIEIKKLLQFL
AGQQVNPTKAVCNLVKNRIVYFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences ENSDORP00000006166 ENSDORP00000006166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]