SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006177 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006177
Domain Number 1 Region: 36-133
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 178-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000034
Family EGF-type module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006177   Gene: ENSDORG00000006594   Transcript: ENSDORT00000006594
Sequence length 648
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4270:114306:330490:1 gene:ENSDORG00000006594 transcript:ENSDORT00000006594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERKEGRGKGKGKKKDRGSGKKLEPAQGNPSPALPPRLKEMKSQESVAGSKLVLRCETS
SEYPTLRFKWFKNGSELNKKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSTSANITIVDSNEISTGMPASTERTFVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKIQNQEKHLGIEF
MEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPS
HSWSNGHTESILSGSHSVIMMSSVENSRHSSPSGGPRGRLNGLGGPRECNSFLRHARETP
DSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFI
EEERPLLLVTPPRLREKKYDHHPPQFNSFHHNPVHESSSLPPSPLRIVEDEEYETTQEYE
PAQEPVKKLTNSRRAKRTKPNGHIANRLEMDSNTSSESSNSESETEDERVGEDTPFLGIQ
NPLAASVEVTPAFRLTDNRTNPAGRFSTQEELQARLSSVIANQDPIAV
Download sequence
Identical sequences ENSDORP00000006177 ENSDORP00000006177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]