SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006201 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006201
Domain Number 1 Region: 524-700
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.36e-46
Family Crystallins/Ca-binding development proteins 0.00016
Further Details:      
 
Domain Number 2 Region: 338-496
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.12e-29
Family Crystallins/Ca-binding development proteins 0.0036
Further Details:      
 
Domain Number 3 Region: 711-838
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 5.24e-28
Family Crystallins/Ca-binding development proteins 0.0055
Further Details:      
 
Domain Number 4 Region: 883-1012
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.65e-26
Family Ricin B-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006201   Gene: ENSDORG00000006618   Transcript: ENSDORT00000006619
Sequence length 1014
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_703:16623:81626:1 gene:ENSDORG00000006618 transcript:ENSDORT00000006619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VADFQPENRVVRLNKIVSLTAVYDKRRELDCSHEKGESNLAFVSQDEQENSSFTILYEEP
LHDDDKYASAEVRGTQPLLFPDVSADSMPVLACERSESRTDLVHHFEKEAKLGETYDGDS
SEMFLSVEAKRYKIYPLALSPIYEDDSSQEDILSSEVSPGHHGSTKSRESANQSSSVLSL
LQSVSERLKMNFDEDDRQAAEEEEEEEEALNKGLGAQRREHVTFHLPDPSFTFYPDEDQS
TEFSNSYPTTNEPAPSNLHGLWSEKALQKCNLTSRLHSLKSAYHQYLQTSKNSSEKARFG
GIFQEPVSQYFPVEDNSGSLSPYMENVDRQTLRCNPRPGKMVIYDLHGSNYKQEIYCTIP
DATAWSFPNGVLIKVVRGCWILYEKAHFQGQKCVLEEGEKVLTRDWFLQSRKHPQRNFVL
GSIKRVLKDCSIPEIELCLKSDPACCPIYIQRAVPNLEDLNIPKSWSFTVKSGVWLAYPD
INFKGQATVWEEDQELFEISASEMKSLYPLQMGGLKVEMPMNLKVIIYEKPHFYGQAKEF
SEHIDSVPNFLENDSDFNGIGSIRVIGGVWVAYEKEHFKGQQFLLEEGDFEDSSACGALC
GPILSFRYLQANFIESSITLFESDLESGKFIDITNQEISDLEEIGYSIETRSIHVKSGVW
VAYQQKFFCGEQYILEKGKYKCFFDWGGSNNIILSIRPVQLEPLGINEPPHWLKVFNKPG
FQGECIDFIKEIADFDSFTPCSFKVLRGCWLLYYQEDIFDHQCVLEEGLYADLSSCGCPA
SRVKALKPIDYVFEEPSISLFALEHCEGRELHLEEAVNSVLNKDLHFYTQSVWVKSGLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAVYIRIKNRAQDKYLTVTGN
LADTRAMSVCISPYNGKDTQIWHYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQF
RQKWKLNKNGTISSYLSDQLVLDVKGGSYYDKAHVIINQPLEGEETQIWDIEIL
Download sequence
Identical sequences ENSDORP00000006201 ENSDORP00000006201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]