SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006222 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006222
Domain Number 1 Region: 5-40,75-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-17
Family Ankyrin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006222   Gene: ENSDORG00000006638   Transcript: ENSDORT00000006640
Sequence length 722
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_892:715:8579:1 gene:ENSDORG00000006638 transcript:ENSDORT00000006640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCVVDVEDSSGWTALHHAAAGGCLSCSELLCSFKAHLNPRDRSGATXXXXXXXXXXXXX
XXXXXXXXXXXXNDQDLQGRTALMLACEGASPETVEVLLQGGAQTGITDALGQDAAHYGA
RVGDKLILHLLQEAVQRPSPPSPPELDSGEASSQNSVSSQEKRGAAKKRKAPQPPASIPV
PDDREAYEEIVRLRQERGRLLQKIRGLEQHKERRRPEPLEPEASSVHSLERQVQELQQLL
AEKQEEKESLGREVESLQSRLSLLENERENTSYDVSTLQDEEGDLPDASGAEALLSPSAR
GLLASLQEQVAELTRQNQELMEKVQILEDFEKEDVQVEANGAPEVIPLLLYDSLRAEFDQ
LRRQHAEALRMLEQQEAPKNPGGHGAAQEEDRDGGAKTPQKRPSSTGLNGTVSPESQVNG
TADEETAGVEATETTTLEIASTNPEATETKRADTEVAGTPGDGAQAVETKATGAEILDGK
MAETENTGIKATGAEATEAEATNPNANPVAAEVKRLGDVEAEGLGTGATNSEAMRAEATD
AEATDAEATAPEVPAGPVLHPGAAEASEKLQAELESRIRGLEEALRQREREAAAELEAAR
GKCEAAEAEAGRLRARVREAEGSGAGGGSGGGDTVQLRAALEQAREDLRGRDSRLRELEA
AVAQLDEARAGRLLAEEEARGLRAELARREEMRLEQSRELEVLREQLATARAAGEKQRAA
AA
Download sequence
Identical sequences ENSDORP00000006222 ENSDORP00000006222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]