SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006237 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006237
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.53e-30
Family Pentraxin (pentaxin) 0.00000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006237   Gene: ENSDORG00000006655   Transcript: ENSDORT00000006655
Sequence length 195
Comment pep:novel scaffold:dipOrd1:scaffold_9021:12537:14473:1 gene:ENSDORG00000006655 transcript:ENSDORT00000006655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVFIFPQESATAHVSLVPLVRKPLQNFTLCLRFKDLTRPYSLFSYSTPSKDNELLLFVNK
MGKYSLTIGNSDAIFGTSTPYAPIHVCVSWESASGLAEWVEGKPLGRKGLMKGYSVGAQA
KIILGQEQDSFGGSFEENQSFVGEIWEVSLWDHVLLLKEMCEWSYSGNILNWQALSHEQC
GYVVTKPKEWAILEC
Download sequence
Identical sequences ENSDORP00000006237 ENSDORP00000006237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]