SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006240 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000006240
Domain Number - Region: 195-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000189
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 164-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000267
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 227-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00402
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 260-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00659
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006240   Gene: ENSDORG00000006658   Transcript: ENSDORT00000006658
Sequence length 329
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4210:54609:108947:-1 gene:ENSDORG00000006658 transcript:ENSDORT00000006658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQATGQAEYFYEFLSLRSLD
KGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNIIVMNSEGNTILQTPQN
AIFFKTCQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCTPRCMNGGLCVTPGFC
ICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQLCRNGGKCIG
KSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGVSLMHALR
PAGARLGQHTPSLKKTEERQDPPESNYIW
Download sequence
Identical sequences ENSDORP00000006240 ENSDORP00000006240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]