SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006364 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006364
Domain Number 1 Region: 130-230
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-30
Family C-type lectin domain 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006364   Gene: ENSDORG00000006793   Transcript: ENSDORT00000006793
Sequence length 233
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_41558:9919:11819:-1 gene:ENSDORG00000006793 transcript:ENSDORT00000006793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEYQDLQHLDNEDNDHHQLRRGPLPSKPRLQRLCSGPRLFLLSLGLSLLLLVVVCVIG
SQNSQMQGELLSLRAIFSNFTVSIEAEFKTLSTQGGNVGRKMKSLESQMEKEQQNLREDH
ISLLVHVKQFVSDLRSLNCQLAGLQGNGSAKSCCPINWVAYEDSCYWFSNSGKPWPEADK
YCQLENAHLVVVNSKEEQQFVQHHTGPINTWMGLTDQNGPWRWVDGTTYDTGF
Download sequence
Identical sequences ENSDORP00000006364 ENSDORP00000006364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]