SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006371 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006371
Domain Number 1 Region: 27-139
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.81e-29
Family Frizzled cysteine-rich domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006371   Gene: ENSDORG00000006802   Transcript: ENSDORT00000006800
Sequence length 659
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1351:9334:29683:1 gene:ENSDORG00000006802 transcript:ENSDORT00000006800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSWIIFYLWLLTMFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMETFIPMNYGCSRDFRPIFCAVLCMEYGRVTCGRLCQRAYSECSKLMEMFGVPWPEDMK
CSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCS
PPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYM
MVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMVLYFFTMAGSVWWVI
LTITWFLAAVPKWGSEAIEKALLFHASAWGIPGTLTIILLAMNKIXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTQMSRPDLILFLMKYLMA
LIVGIPSIFWVGSKKTCFEWASFFHGRRKKEMVNESRQVLQEPDFAQSLLRDPNTPIIRK
SRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPCSYRGMEE
RLPHGSMSRLTDHSRHSSSHRLNEQSRHGSTRDLSNNPMTHITHGTSMNRVIEEDGTSA
Download sequence
Identical sequences ENSDORP00000006371 ENSDORP00000006371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]