SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006441 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006441
Domain Number 1 Region: 104-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000232
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 44-92
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000123
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 519-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006441
Domain Number - Region: 177-247
Classification Level Classification E-value
Superfamily Superantigen MAM 0.0732
Family Superantigen MAM 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006441   Gene: ENSDORG00000006874   Transcript: ENSDORT00000006874
Sequence length 569
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1875:13931:47934:-1 gene:ENSDORG00000006874 transcript:ENSDORT00000006874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGSWFTLAICILEISPPLVQPTPSDSPSPMQENDYPWSIDPINCRMSPWSEWSLCDPC
LKERFRSRSIEVFGQFNGKRCHDALGDRQACVPTVACAEAKDGCGNDFQCGTGRCIKRRL
LCNGDNDCGDFSDEDECDSDPRPPCRDRVVEESELARTAGFGINILGMDPLGTPFDNEYY
NGLCDRVRDGNTLTYYRRPWNLAFLAYETKVDKNFRTENYEEEIEIFTTIMQEKISSFNA
NLAIKLTPTETNKNNAEETTEKKESSKSERFSSDLKFHEIKNETYKRLWSYSSSKGKQFL
YVKGVVQLGKFLMRNRNVVLTQTFLDDIEALPTTYAKGEYFGFLETYGTHYSSSGAVGGL
YELVYVLDKASMKEKGIEVSDIKRCLGYSLDVSLSIPGVSDGLEVKGAVNKNDCVKRGEG
RIVNITRENFIDDVISLIRGGTGKYAFELKQKLLKGAKVIDVTDFVNWASSLSDAPVLIS
QKLSPIYNLVPVNIKDAHMKKQNLERAIGDYVDEFSPTKCSPCQNGGTVILLDGECVCSC
PPAFKGLACEIKKHQLSDSPVLPSLKKKW
Download sequence
Identical sequences ENSDORP00000006441 ENSDORP00000006441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]