SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006462 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006462
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 3.66e-47
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1077-1204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-17
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 440-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000123
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number 4 Region: 2189-2259
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000196
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 5 Region: 1430-1554
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000029
Family SPRY domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006462   Gene: ENSDORG00000006887   Transcript: ENSDORT00000006895
Sequence length 5033
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3312:46102:154140:1 gene:ENSDORG00000006887 transcript:ENSDORT00000006895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSC
LTTSRSLTDKLAFDVGLQEDATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
HLSTASGELQVDASFMQTLWNMNPICSCCEEGYVTGGHVLRLFHGHMDECLTISPSDSDD
QRRLVYYEGGSVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLV
VVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDTKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDS
FSGKPRGSGPPVGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQE
EGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALF
STNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRPNIFVGRAEGSTQYG
KWYFEVMVDEVVPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLH
LWTGHARPVTSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEVLPRERLHLESIKEYRRERPRGPHLGPS
RCLSHTDFVCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGQVRDDNKRLH
PCLVDFHSLPEPERNYNLQMSGETLSKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSN
GYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVP
YRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQAENQSRGDRTRIFRAEKSYVV
QSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSESFGRPW
QSGDVVGCMIDLTENNIIFTLNGEILMSDSGSETAFREIEIGDGFLPVCSLGPGQVGHLN
LGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXFLFKAKKAAMMTQPPATPVLPRLPREVVPTDNRDDPEIILNTTTYYYSVRVFAGQ
EPSCVWVGWVTPDYHQHDMTFDLTKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSP
GQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQ
FELGKLKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGER
LGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRAVCALGNNRVAH
ALCSHVDQAQLLHTLEDAHLPGPLRAGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMGVFSDEDVKQI
LKMIEPEVFTEIEEEEEEAEEEEEEDEEEKEEDEEEEAQEKEDEEKEEEEAAEGEKEEGL
EEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQGNQRGRYGLLMK
AFTMSAAETARRTREFRSPPQEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLQELVSHMV
VRWAQEDFVQSPELVRTMFSLLHRQYDGGELLRALPRAYTISPSSADTMSLCLQIRSLLI
XXXXXXXXXXXXXXXXNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPK
MVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELA
LALQEQDLEKVVSYLACGLQSCPMLLAGYPDIGWNPCGGERYLDFLRFAVFVNGESVEEN
ANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRRPHFGEEP
PEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDLVGII
SLPLQMPTLGKDGALVQPKMSASFVPDHKASIVLFLDRVYGIDNQDFLLHVLDVGFLPDM
RAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLS
RGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLINHYER
CWKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYDQELYRIAMPCLCAIAGAL
PPDYVDASFSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYSHEKWAFDK
IQNSWSYGENIDEEQKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGE
EEKTEKKKTRKISQTAQTYDPREGYSPQPPDLSGVTLSRELQXXXXXXXXXXXXXXXXXX
XXXXXXXXGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDTSS
IEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYF
TNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHI
LARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLT
YTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEKLRPAL
GECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTDEEVR
EFLQNNLNLQGKVEGSPSLRWQMALYRGLPGREEDADDPEKIVRRVQEVSAVLYHLEQTE
HPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFE
DRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMA
KSCHMEEGGENGEAEGEEEAEVSFEENEMEKQRLLYQQSRLHNRGAAEMVLQMISACKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDLNAFER
QNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEN
GEKEEVQEPPPEEPPTKTAPPPPPPKKEEAGGAGLEFWGELEVQRVKFLXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVSDSPPGEDDMEGSAAGEMSGAGSGGGSGWGSGAGEEVEGDE
DENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDKHGDIFGRERIAELLGM
DLASLEITAHSGRKPEPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGH
YNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFY
NKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFF
VIVILLAIIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXYLIKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences ENSDORP00000006462 ENSDORP00000006462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]