SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006486 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006486
Domain Number 1 Region: 322-415,444-483
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.79e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 158-247
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000000000000459
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0027
Further Details:      
 
Domain Number 3 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0000000115
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006486   Gene: ENSDORG00000006920   Transcript: ENSDORT00000006920
Sequence length 536
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2025:50116:72941:1 gene:ENSDORG00000006920 transcript:ENSDORT00000006920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGDPALIRETQEKRFKDPRLVDQLVKADSEWRRCRFQADNLNKLKNLC
SKTIGEKMKKKEPVGEDGSVPENVLNFDDLTADTLATLKVSQIKKVRLLIDEAILKCDAE
RIKLEAERFENLREIGNLLHPSVPISNDEDADKVERIWGDCTVRKYSHVDLVVMVDGFEG
EKGAIVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQEVAQLSQ
FDEELYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXIEQFVYASPHDNKSWEMFEEMIATAEEFYQSLGIPYHIV
NIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKRKN
NLRLSTQNKLEAVSSFFSPKKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKE
FMPPGLQELIPFVKPAPIDQEPSKKQKKQHEGNIKKAAAREVTLENRLQNMKVTEA
Download sequence
Identical sequences ENSDORP00000006486 ENSDORP00000006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]