SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006488 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006488
Domain Number 1 Region: 1349-1576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-39
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 394-506
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-31
Family Cadherin 0.00055
Further Details:      
 
Domain Number 3 Region: 810-922
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 4 Region: 1599-1792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-28
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 5 Region: 499-604
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-27
Family Cadherin 0.00067
Further Details:      
 
Domain Number 6 Region: 179-282
Classification Level Classification E-value
Superfamily Cadherin-like 5e-26
Family Cadherin 0.00079
Further Details:      
 
Domain Number 7 Region: 910-1025
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-26
Family Cadherin 0.00088
Further Details:      
 
Domain Number 8 Region: 284-392
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-26
Family Cadherin 0.00079
Further Details:      
 
Domain Number 9 Region: 701-805
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 604-705
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.00097
Further Details:      
 
Domain Number 11 Region: 1018-1120
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000228
Family Cadherin 0.0079
Further Details:      
 
Domain Number 12 Region: 1276-1366,1563-1612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000832
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1925-1965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 1831-1877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000313
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1796-1830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006488
Domain Number - Region: 2426-2639
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0915
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006488   Gene: ENSDORG00000006923   Transcript: ENSDORT00000006922
Sequence length 2921
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2025:86730:114360:1 gene:ENSDORG00000006923 transcript:ENSDORT00000006922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRAASVPLPTPPPLLLLLLLLLPLPPLRGDQVGPCRSLGSGGRGSSGACVPVGWLCPA
SASNLWLYTSRCRDAGTELIGHLVPHHDGLRAWCPESGAHIPLPPAPEGCPWSCRLLGIG
GHLSPQGKLTLPQEHPCLKAPRLRCQSCRLTQAPGLRAGEEEPAEEALGGRRKRNVNTAP
QFQPPSYQATVPENQPAGTSVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPITG
VVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTISVTDTNDHDPVFEQQEYKESLR
ENLEVGYEVLTVRATDGDAPPNANILYRLLEGFGGNPSEVFEIDPRSGVIRTRGPVDREE
VESYKLIVEASDQGRDPGPRSATAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVL
RVTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQDG
GRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNAR
LEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGVPALSASASVSVT
ILDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSIT
SQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTV
NVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQV
SYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSIYEDVPPFTSVLQISA
TDRDSGLNGRIFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMP
PARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQ
IVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRNDN
PPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNAST
GELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMSPE
RFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPF
LPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASS
SVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDGYT
GEHCEVSARSGRCSPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPARSFIT
FRGLRQRFHFTLALSFATKERNGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTV
SPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGAAL
GNYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRHFVGCMRNLQVDSRHVDMA
DFIANNGTIPGCPTKKNVCDSNTCHNGGTCVNQWDTFSCECPLGFGGKSCAQEMANPQRF
LGSSLVAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLREGHVVLSVEG
TGLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQKAEGNLGPRLHGLHL
SNITVGGVPGPASGVARGFRGCLQGVHISEAPEGVSSLDSSRGESINVEPGCSLPDPCDS
NPCPANSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPHGYTCECPP
NYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSP
TCLLCDCYPTGSLSRVCDSEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRA
IEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAER
LQRNESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESAQRGFGLSAT
QDVHFTENLLRVGSALLDAANRRHWELIQQTEGGTAWLLQHYEAYASALAQNMRYTYLSP
FTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPESVFREIPPVLRPA
GAGEAQEQEELARRQRRHPELSHGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPVIN
TPVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGC
EVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFLFLT
LLRALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALL
EALHLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTL
IWSFAGPVAFAVSMSVFLYILAARASCAAHRQGFEKKGPVSGLRPSFAVLLLLSAAWLLA
LLSVNSDTLLFHYLFAACNCVQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTKST
LTSSYNCPSPYADGRLYQPYGDSAGSLHSASRSCKSQPSYIPFLLREESTLNPGQGPPGL
GDPGGLFLEGQDQQHDPDTDSDSDLSWEDDQSGSYASTHSSDSEEEDEEEESLFSGEGWD
SLIGPGXXXXXXXXXXXXGGPGPGKVPWPGDFGFTAKESAGSGTLEERPRENGDALSREG
TLGPLPGPSAQPHKGILKKKCLPTISEKSSLLRLPLEQGTGSSRGSSASEGSRMGPPPRP
PPRQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences ENSDORP00000006488 ENSDORP00000006488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]