SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006504 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006504
Domain Number 1 Region: 20-134
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-28
Family C-type lectin domain 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006504   Gene: ENSDORG00000006938   Transcript: ENSDORT00000006938
Sequence length 135
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_10869:12464:13306:-1 gene:ENSDORG00000006938 transcript:ENSDORT00000006938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHKAQQLMGVLRLQGSVLAVGEKVFSTSGQSANFDAIREMCARAGGDIAVPRSSEENAAI
ASLVKKYNIYAYLGLDAGPAPGDFHYLDGAPVNFTSWYPGEPRGRGKEKCVEMYTDGTWN
DKNCLQYRLAICEFE
Download sequence
Identical sequences ENSDORP00000006504 ENSDORP00000006504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]