SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006539 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006539
Domain Number 1 Region: 212-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.8e-55
Family Reprolysin-like 0.0000309
Further Details:      
 
Domain Number 2 Region: 430-504
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.19e-19
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006539   Gene: ENSDORG00000006974   Transcript: ENSDORT00000006975
Sequence length 863
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4610:38045:55366:1 gene:ENSDORG00000006974 transcript:ENSDORT00000006975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLALLWALGLLGAGSPRPSPPLPNTGGSEEQQTRPEKVKSGSLEHQVLQDNPPVPPAEV
LPTSSPEALRIQLELDGENHIIELLPNRDLVPGRPTLVRYQPDGTRVVSEGHTLENCCYQ
GGVQGHARSWVSICTCSGLRGLVVLSPERSYAVDLGPGDLQGSPIISRIQDNLLPHHSCA
LRRHVPMPTQASPDLPLGQHHLHRKRDVITESKIVELVIVADHSEVRRYPDFQRLLNRSL
EVALLLDTFFRPLNVRVVLVGLEAWTQRDLVEIVQNPAVTLENFLHWRRANLLPRLPHDS
AQLVTDTFFSGPTVGMAIQNSICSPDFSGGVNMDHSASIVGVASSIAHELGHSLGLDHDS
PGRSCPCPGPAPSKSCIMEASTDFLPGLNFSNCSRQALEKALLDGMGSCLFERLSNLPAM
SSSCGNMFVDPHEQCDCGFPDSCTDPCCDAFTCQLRPGAQCASDGPCCQNCQLRPAGWQC
RPPRGDCDLPEFCSGDSAQCPADVSLGDGEPCAGGQAVCMHGRCASYTQQCRSLWGPEAQ
PAAPFCLHTANTRGNAFGNCGRSPNGSYIPCTSRDAMCGQLQCQGGRAQPLLGLAQGLRW
ETLAVNGTQLNCSWVHLDLGNDVAQPLLALPGTACGPGLVCIDHRCQPVDLLGAQECRSR
CHGHGVCDSNRRCHCEEGWAPPDCITQLRATSSLTTGLLLSLLLLLVLLLLGASYWYRAR
LQQRLCQLKGTSCQYRAAQSGPSERPGPSQRPQMMPNIKQASALGFPAPPSRPLPPDPVP
KKLQAALADRPNPPTRPLPADPVVRHPKSQGPAKPPPPRKPLPADPQGRRPSRDLPGSGA
GIIPLVVPSRPAPPPPALSSLYL
Download sequence
Identical sequences ENSDORP00000006539 ENSDORP00000006539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]