SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006557 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006557
Domain Number 1 Region: 257-371
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-31
Family C-type lectin domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 216-254
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000000981
Family Triple coiled coil domain of C-type lectins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006557   Gene: ENSDORG00000006993   Transcript: ENSDORT00000006994
Sequence length 371
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5452:41410:52178:1 gene:ENSDORG00000006993 transcript:ENSDORT00000006994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLSMLVLFSQPVGYLGAEMKTLARRSVNNACTLVMCGPAENGLPGRDGRDGREGPRG
EKGDPGLPGPVGPAGMPGPSGRIGPKGDNGSDGEPGQKGDSGPAGPPGLPGAPGPAGKDG
PSGKQGNTGPQGKPGPKGESGPKGEVGALGMQGSPGPRGPSGPKGERGERGVPGNAGPAG
PAGAVGPQGAPGTRGPPGVKGDRGAPGDRGAKGESGLQDITALRGQVETLQGQLQRLQAD
ISHYKKAMLFPDGQSMGDKIFKTAGFVKLFQGAQEVCTQAGGQLASPRSAAENKALQQLV
IAQNKAAFLSMTDNDTEGKFTYPTGEPLVYTNWAPGEPNNNGGSENCVEIFTNGQWNDKT
CGEERLVVCEF
Download sequence
Identical sequences A0A1S3GFP5
XP_012887530.1.60039 ENSDORP00000006557 ENSDORP00000006557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]