SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006629 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006629
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 125-180
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000432
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006629   Gene: ENSDORG00000007072   Transcript: ENSDORT00000007073
Sequence length 183
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6730:181345:185060:1 gene:ENSDORG00000007072 transcript:ENSDORT00000007073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDGPGRCSGRVEVLHQGAWGTVCDDLWDLKEAEVVCRQLGCGTAISGPGEAYFGPGSGDI
FLDNFQCFGIEQYLGQCAHSDWLEHNCGHHEDASVICSDAEDALPPTPPGPLVSSWDPVA
GQNNSCGGVISSLSGLFSSPQYPENYPTDIQCVWEIHVDKKFHIELMIPSLNVIPKDRCV
CHP
Download sequence
Identical sequences ENSDORP00000006629 ENSDORP00000006629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]