SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006660 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006660
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-17
Family PWWP domain 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006660   Gene: ENSDORG00000007105   Transcript: ENSDORT00000007105
Sequence length 174
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_24815:4284:8531:-1 gene:ENSDORG00000007105 transcript:ENSDORT00000007105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEI
ENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEDEGDRVEEDGKGKRKNEKGGSKRKK
SYASKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEG
Download sequence
Identical sequences ENSDORP00000006660 ENSDORP00000006660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]