SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006665 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006665
Domain Number 1 Region: 21-357
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.23e-108
Family Phosphofructokinase 0.000000237
Further Details:      
 
Domain Number 2 Region: 348-769
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.81e-105
Family Phosphofructokinase 0.00000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006665   Gene: ENSDORG00000007109   Transcript: ENSDORT00000007110
Sequence length 784
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_464:942:71302:1 gene:ENSDORG00000007109 transcript:ENSDORT00000007110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDDFRVLESSLGKYLEHLSGAGRAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIY
EGYQGMVDGGSNIQEADWESVSSILQVGGTIIGSARCQVFRTREGRLKAACNLVRLGITN
LCVIGGDGSLTGANLFRKEWSGLLEELAENGEIDNEAVQKYAHLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEEGWEESMCVKLSENRARKKRLNIIIVAEGAIDRQNKPISSETIKDLVVKQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLSGNQAVRLPLVECV
QMTQDVQKAMDERRFKDAVQLRGRSFEGNLKTYKRLAIKLPDDQITKSNCNVAIINVGAP
AAGMNAAVRSAVRVGISDGHKMFAIYDGFDGFAKGQIKKIGWSDVGGWTGQGGSILGTKR
ILPGKYLEQIAKQMKNHNINALLVIGGFEAYLGLLELAAAREHYEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAAGAD
AAYIYEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLXXXXXXXXXXHTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGSPSPFDRNFGTKISARAMEWITVKLKESAGKGKKFTSDDSICVL
GICKRNLVFQPVAELRQKTDFEHRIPKEQWWLKLRPVMKILAKYEASYDVSDSGKLEPLR
PRSV
Download sequence
Identical sequences ENSDORP00000006665 ENSDORP00000006665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]