SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006686 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006686
Domain Number 1 Region: 54-170
Classification Level Classification E-value
Superfamily PR-1-like 3.79e-32
Family PR-1-like 0.00074
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily LCCL domain 2.62e-29
Family LCCL domain 0.001
Further Details:      
 
Domain Number 3 Region: 391-495
Classification Level Classification E-value
Superfamily LCCL domain 3.53e-28
Family LCCL domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006686   Gene: ENSDORG00000007128   Transcript: ENSDORT00000007131
Sequence length 500
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2264:29553:70668:1 gene:ENSDORG00000007128 transcript:ENSDORT00000007131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCTAREWLRVTTVLFMARAIPAMVLPNATLLEQLLEKYMNEDGEWWTAKQRGKRAITDN
DMQSILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWAETCLWEHGPSSLLPSIGQNL
GAHWGRYRPPTFHVQAWYDEVRDFSYPYEHECNPYCPFRCSGPVCTHYTQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGSDGYYPAREEETNEIERQQAQVHDSHVRTRSDDSNRNEVISTQQMSQIVSCEVRLR
DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNEGGWVDITRQEG
KLYFIKSNKNGIQTIGKYQSANSFTVSKVTVQAITCETTVEQLCPFHKPTSHCPRVYCPR
NCMQANPHYARVIGSRIYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKMYTASFQNGI
FSESLQNPPGGKAFRVFAVV
Download sequence
Identical sequences ENSDORP00000006686 ENSDORP00000006686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]