SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006716 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006716
Domain Number 1 Region: 185-308
Classification Level Classification E-value
Superfamily TIMP-like 2.51e-20
Family Netrin-like domain (NTR/C345C module) 0.064
Further Details:      
 
Domain Number 2 Region: 57-98
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000000549
Family Frizzled cysteine-rich domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006716
Domain Number - Region: 146-169
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0017
Family Frizzled cysteine-rich domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006716   Gene: ENSDORG00000007162   Transcript: ENSDORT00000007162
Sequence length 314
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_1722:44795:87078:1 gene:ENSDORG00000007162 transcript:ENSDORT00000007162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRSAGGRYGAAWGVLLALTAGLMAEASASEYDYVSFQSDIGSYQSGRFYTKPPQCVD
IPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTNVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KELKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK
Download sequence
Identical sequences ENSDORP00000006716 ENSDORP00000006716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]