SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006724 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006724
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000418
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006724   Gene: ENSDORG00000007171   Transcript: ENSDORT00000007170
Sequence length 302
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1136:78119:109284:1 gene:ENSDORG00000007171 transcript:ENSDORT00000007170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHGRIAPKSSSAFAVASVGHGVFLPLLILSTLLGDGLASVCPLPPEPENGGYICHPQPC
RDPLTAGSVIEYLCAEGYMLKGDYKYLTCKDGEWKPAMEISCHLNEDKETHTSLGVPALS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCMPPADPRVQIVLSEGSGPSGRNLPRDQQLQVQGACSSASMEDETPGQSGLCE
AWGSRGSEAVMVHQATTSSWVAGSGSSRLAHKDTADSENSDIQSLLSLTSEEYTDDIPLL
RA
Download sequence
Identical sequences ENSDORP00000006724 ENSDORP00000006724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]