SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006731 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006731
Domain Number 1 Region: 182-398
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.84e-68
Family Fibrinogen C-terminal domain-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006731   Gene: ENSDORG00000007178   Transcript: ENSDORT00000007177
Sequence length 406
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5070:307:11035:1 gene:ENSDORG00000007178 transcript:ENSDORT00000007177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCAPTAGAALVLCAATAGLLRAQAGAAPPPPEPPRFASWDEMNVLAHGLLQLGRGLHEH
VERTRGQLGALERRLAACGAACQTSETTGVPSASGRRVAPEILRDLQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLPKDCQELFEDGQRQSGLFQIQPQGSPPFLVNCEMTSEGGWTVIQRRQDGSVDFNQ
PWEYKAGFGDPQGEFWLGLEKIHSITGDRGGRLAVQLQDRDGNAKSLKFPVHLGGEDTAY
SLQLTAPVASELGVSVATSNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCGHSNLN
GQYFHSMPHQRQQRKKGMFWKGWRGRYYPLQATTMLIQATEDKEAS
Download sequence
Identical sequences ENSDORP00000006731 ENSDORP00000006731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]