SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006777 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006777
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-66
Family SPRY domain 0.0000000105
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006777
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000445
Family SOCS box-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006777   Gene: ENSDORG00000007229   Transcript: ENSDORT00000007229
Sequence length 273
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_14534:16315:21768:1 gene:ENSDORG00000007229 transcript:ENSDORT00000007229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSHDIQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGKERLGAIPTLPLPASLKAYLLYQ
Download sequence
Identical sequences A0A1S3GCJ8
XP_012886563.1.60039 ENSDORP00000006777 ENSDORP00000006777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]