SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006798 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006798
Domain Number 1 Region: 353-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-41
Family SPRY domain 0.00045
Further Details:      
 
Domain Number 2 Region: 159-350
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-25
Family Fibronectin type III 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006798
Domain Number - Region: 22-154
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.051
Family MW0975(SA0943)-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006798   Gene: ENSDORG00000007252   Transcript: ENSDORT00000007252
Sequence length 536
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_25667:5802:19301:-1 gene:ENSDORG00000007252 transcript:ENSDORT00000007252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEIHRNMYRLEQQIIDMENFASHLEEVFVTVEENFGRQEQNFESHYNEILETLAQNYEEN
IQALGERKKEKLEALYGQLVNCGESLETCKELMEAIEEVCHQDKANFLKVRNTAHYRLGN
FLKTQTDVEISAQPDFEDQTLDFTEVEQLMGSMNAIPAPSAPVINRQAPNSATSSSVRVC
WSLHSDDTVERYQLCYRPAQDGSPHKDHAEFTVTVKETYCSVRNLEPNTQYEFWVIAENR
AGPSPSSEVATYVTAPSPPVIRCEEIRSCERAALISWESGNRSPVDSYTVELTLAETPEA
SGVTESVVGIPTCESLIQLLPGQRYIIYVRALNVGGSSARSQPATVHTTGTVFHLNKDTC
HPALTISEDGLTVLRNERKTPAREPPPSRSRFSRCAAVMGNLIPVRGRHYWEVEVDEHSD
YTVGVAAEDIPRQEDLGASPQAWCLRHTFSSSRHKYEFLHNGKTPDIRITVAPKQIGVLL
DYEKSKLSFFNADNSQHLYTYSCQLHRFVHPCFSLEKPGCLKIRNGISTPRHASFC
Download sequence
Identical sequences ENSDORP00000006798 ENSDORP00000006798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]