SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006824 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006824
Domain Number 1 Region: 215-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.11e-43
Family Reprolysin-like 0.0000807
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006824
Domain Number - Region: 429-463
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000589
Family Blood coagulation inhibitor (disintegrin) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006824   Gene: ENSDORG00000007279   Transcript: ENSDORT00000007279
Sequence length 470
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2859:913:17197:1 gene:ENSDORG00000007279 transcript:ENSDORT00000007279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLCEFQPAVARMSWVLFSVLWLIVQTQAKTVKQGPELKLQEIVHPRKLPFAYQSEIEKEK
NDEEXXXXXXXXXXXXXXXXXXXXXXXXXXFRLGSDGAETKHSSGAENVTRNPQNRRHCH
YEGHILNEQNSAASISTGDGLXXXXXXXXXXXXKLVIRPLGSTDQGEHAVFAYNQEELDT
VNVNPTGGVNGMGRKQRHIRPSRSLRVLKQEEFLQTQKYVNLFLVLDNAFYKTYHGNLTL
MKTVLFDVLSLLNVIYNTIDVQVALVGMEIWSDGDKIKVEPTIGTTFNNFLRWHRSSIGK
MRIHNHAQLLSGIGFRHGRVGMVAPFLCSLSSVAVIEAKRKNNVTLAAVMSHELGHALGM
PDIPYFTKCPSGSCAMNQYLSSKFPKDFSTSCREHFRRYLLSHKPKCLLQAPSPKSVMTP
PVCGNHILEVGEDCDCGSPEGCTNGCCEPLTCRRKPGPGCGQTPPYLTTK
Download sequence
Identical sequences ENSDORP00000006824 ENSDORP00000006824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]